Purity 99% HPLC
RUO: Research Use Designation Only. Not for human or veterinary use.

TB-500 (Thymosin Beta 4 Frag and TB-500aa) is a 43 amino acid long peptide that enhances cellular growth, regulates cell structure, and assist in DNA replication. In research studies, TB 500aa has been shown to increase cell growth and migration which can aid in wound healing and injury repair. By enhancing cellular growth TB 4 has shown to boost the immune response to injury and infection

Pre-Clinical Research has indicated that TB 4 Frag helps immune cells replicate faster and move to areas where they are needed to help with infection or injury. Studies also show they alter inflammatory response in a beneficial way.

Research shows healing abilities, protective abilities, wound healing assistance, collagen synthesis, modulated inflammatory response and protection against oxidative stress. Research has shown benefits in neurons which leads to improved blood vessel growth in the brain as well as increased neural growth. Studies show that this could potentially lead to improvements in behaviors, motor control and cognition.

Research has also shown that TB 4 Frag can slow cognitive disease and help enhance autophagy (the removal of waste toxins and debris.) Increased autophagy has shown to decrease some of the cognitive effects of Alzheimer’s patients.

Research shows that using TB 4 Frag can aid in recovery after cardiac procedures and encourage cell survival if used during urgent cardiovascular events. All studies point to the positive effects of TB 4 Frag on wound healing, cognitive health, nerve growth, and cardiac health.

TB 4 Frag Structure

CAS Number: 77591-33-4
Chemical Formula C₂₁₂H₃₅₀N₅₆O₇₈S
Molar Mass: 4963 g/mol
Amino Acid Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
PubChem CID: 45382195

Notes: TB 4 Frag/TB 500aa is available in nasal, capsule, and injectable formats. The peptide is stable in the GI Tract. TB 4 Frag has shown improved rates of healing, remodeling and improvements in tendon and ligament strength in animals. Researchers have found it’s a impactful tool for research into regenerative therapies, improved healing and gut wellness in animals.

Stability and Bioavailability: TB 4 Frag is stable in the GI Tract and can be administered in a variety of ways including dissolving it in water or mixing with food for oral bioavailability. TB 4 Frag can be administered Sub-Q or orally in capsule format for research with lab animals.

TB 4 Frag Insights and Referenced Citations:

• TB 4 Frag improves endothelial dysfunction through enhancing dia-hiPSC-EC viability and proliferation, reducing senescence and endothelin-1 and MMP-1 secretion, and improving reparative potency of dia-hiPSC-ECs for treatment of ischemic limb disease in mice with T2DM. 

Stem Cell Research Therapy 13, Article number: 13 (2022) Su, Kong, Loo, Gao, Liu, Su, Dalan, Ma, Ye

• Multifunctional Regenerative Peptide – Naturally occurring peptide plays a vital role in repair and regeneration of cells and tissues. TB 4 promotes cell migration, mobilization, migration, and differentiation of stem/progenitor cells, which form new blood vessels and regenerate the tissue.

Expert Opin Biol Ther. 2012 Jan;12 (1):37 51.doi:10.1517/14712598.2012.634793.Epub 2011 Nov 10; Goldstein, Hannappel, Sonse Kleinman

• Wound Healing – TB 4 is a potent wound healing factor with multiple activities that may be useful in the clinic. Increased collagen deposition and angiogenesis were observed in treated wounds.

J Invest Dermatol. 1999 Sep;113 (3):364-8. Doi: 10.1046/j.1523-1747.1999.00708.x. Malinda, Mani, Banaudha, Maheshwari, Goldstein, Kleinman.

Usage: TB 4 Frag/TB 500aa is sold for in vitro testing and laboratory research purposes only. Pure Bio Labs offers select peptides for investigatory and research strategies. All peptides should be handled by licensed, qualified professionals.

Quality Assurance: Every Pure Bio Research Material undergoes rigorous testing to ensure purity, potency and consistency.